Protein Info for mRNA_1632 in Rhodosporidium toruloides IFO0880

Name: 10000
Annotation: K00036 G6PD, zwf glucose-6-phosphate 1-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00479: G6PD_N
  • amino acids 2 to 122 (121 residues), 133.3 bits, E=1.6e-42
• TIGR00871: glucose-6-phosphate dehydrogenase
  • amino acids 3 to 407 (405 residues), 539.4 bits, E=3.9e-166
• PF02781: G6PD_C
  • amino acids 124 to 406 (283 residues), 375.9 bits, E=1.3e-116

Best Hits

Swiss-Prot: 65% identical to G6PD_EMENI: Glucose-6-phosphate 1-dehydrogenase (gsdA) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K00036, glucose-6-phosphate 1-dehydrogenase [EC: 1.1.1.49] (inferred from 71% identity to cne:CNG03280)

Predicted SEED Role

"Glucose-6-phosphate 1-dehydrogenase (EC 1.1.1.49)" in subsystem Entner-Doudoroff Pathway or Pentose phosphate pathway (EC 1.1.1.49)

MetaCyc Pathways

• pentose phosphate pathway (8/8 steps found)
• pentose phosphate pathway (oxidative branch) I (3/3 steps found)
• superpathway of glucose and xylose degradation (13/17 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (12/16 steps found)
• Entner-Doudoroff pathway I (6/9 steps found)
• cytosolic NADPH production (yeast) (3/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (10/15 steps found)
• formaldehyde oxidation I (3/6 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• heterolactic fermentation (11/18 steps found)
• L-lysine biosynthesis VI (3/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (10/18 steps found)
• aspartate superpathway (15/25 steps found)
• L-lysine biosynthesis I (3/9 steps found)
• L-lysine biosynthesis II (3/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Glutathione metabolism
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.49

Protein Sequence (423 amino acids)

>mRNA_1632 K00036 G6PD, zwf glucose-6-phosphate 1-dehydrogenase (Rhodosporidium toruloides IFO0880)
MKKKLEEFLERCSYVSGQYDKDDGFEELEKELKKCEETYEDKKAPKNRVFYMALPPSVFT
VVAANFKKHNYSEGGINRIIVEKPFGKDLESSREMQVDLKKEWKEEEIFRIDHYLGKEMV
KNLLVLRFANVMLDASFNKNLISNVQITFKEPFGTEGRGGYFDEFGIIRDVMQNHLLQVL
SILTMERPVSFSSEDIRDEKVKVLRYIPEIKFEDVLLGQYTASGDKPGYLDDETVPKGSI
CPTFASCVLHINSPRWEGVPFILKAGKALNEQKTEIRIQYKDVTQGIFKEITRNELVIRV
QPGEAVYLKMNSKAPGLAMRTVPTEMDLTYKRRFSDLKIPEAYEALILDALNGDHSNFVR
DDELDIAWKIFTPILHYIDEKKPRPHSYAYGSRGPEELEKFVQDKGGFVRSSANYTWPST
SVL