Protein Info for mRNA_1687 in Rhodosporidium toruloides IFO0880

Name: 10055
Annotation: K02969 RP-S20e, RPS20 small subunit ribosomal protein S20e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 123 TIGR01046: ribosomal protein uS10" amino acids 23 to 121 (99 residues), 139.8 bits, see alignment E=1.6e-45 PF00338: Ribosomal_S10" amino acids 26 to 120 (95 residues), 91.1 bits, see alignment E=2.3e-30

Best Hits

Swiss-Prot: 75% identical to RS20_SCHPO: 40S ribosomal protein S20 (rps20) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: None (inferred from 80% identity to uma:UM03237.1)

Predicted SEED Role

"SSU ribosomal protein S20e (S10p)" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (123 amino acids)

>mRNA_1687 K02969 RP-S20e, RPS20 small subunit ribosomal protein S20e (Rhodosporidium toruloides IFO0880)
MSTVAKQDAKDFDQSAAPAVKSHKIRITLTSRNVKNLEKVCTDLVNRSKDKQLRVKGPVR
LPTKRLHIVTRKTPCGEGSKTWDHLEMKIHKRLIDLESPAEVVKQITSMSIESGVEVEVT
IAA