Protein Info for mRNA_1689 in Rhodosporidium toruloides IFO0880

Name: 10057
Annotation: KOG1286 Amino acid transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 576 transmembrane" amino acids 82 to 103 (22 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 152 to 169 (18 residues), see Phobius details amino acids 189 to 206 (18 residues), see Phobius details amino acids 217 to 240 (24 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 380 to 383 (4 residues), see Phobius details amino acids 407 to 428 (22 residues), see Phobius details amino acids 436 to 463 (28 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details amino acids 517 to 537 (21 residues), see Phobius details PF00324: AA_permease" amino acids 81 to 542 (462 residues), 369.3 bits, see alignment E=2.9e-114 PF13520: AA_permease_2" amino acids 82 to 505 (424 residues), 110.4 bits, see alignment E=1e-35

Best Hits

Swiss-Prot: 38% identical to PUTX_EMENI: Proline-specific permease (prnB) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 50% identity to cci:CC1G_03688)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (576 amino acids)

>mRNA_1689 KOG1286 Amino acid transporters (Rhodosporidium toruloides IFO0880)
MAPAAQDTSLPFVDVVSYPPAARLSLPTTSAPSFRSSTPSHARSSATGEELKDKEGRPLV
DFRMIAEGSQQGLRRQLRARHIALISIGGVIGTGLFLGTAQSLAIGGPLSLLLSYIVMGV
LVWAMMTVGEMISHLPLAGGHVTLAARMVDPAFGLACGWVYCANWLLVMPAELSAAATLI
GFWSNANPAGWIAICYVLVVLINLGGTRVYGELEFWFASIKIVTIVGLLILSIVITAGGV
PGTEPIGFAYYRDPGPFQQFLGISGPVGRFAGFVAVLTRAAYAYVGSEIVSIAAGEARNP
SRSLPQAIRRIIFRIGLFYIAGAFAIGLIVAANDPALSRNDGTALSSPFVVAIERAEIDV
LPSVINAAFLTSATSAASSGLYTASRCLYGLSVNSLLPPALARLNSYGLPWVSVLTASAF
GLLSFMSAGSHHAAVVFSWLSNFCSVGGIVTWAAICYCYIRWYHAAKAQDIPRDFFPYKA
PFQPYSAYIALAGFLLVLLSQGFYLCIDGQWNASDFVTRYLMILLFPLTYLGGRLWLRCE
TLSLLEIDFFSGSRDNDETPVEKPRTPLKRFLKALV