Protein Info for mRNA_1713 in Rhodosporidium toruloides IFO0880
Name: 10081
Annotation: KOG0022 Alcohol dehydrogenase, class III
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 37% identical to GEOA_CASDE: Geraniol dehydrogenase (geoA) from Castellaniella defragrans
KEGG orthology group: K00055, aryl-alcohol dehydrogenase [EC: 1.1.1.90] (inferred from 42% identity to smt:Smal_3489)MetaCyc: 37% identical to geraniol dehydrogenase (NAD+) subunit (Castellaniella defragrans)
RXN-11968 [EC: 1.1.1.347]; Perillyl-alcohol dehydrogenase. [EC: 1.1.1.347, 1.1.1.144]
Predicted SEED Role
"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)
MetaCyc Pathways
- 3-methylbutanol biosynthesis (engineered) (6/7 steps found)
- ethanol degradation II (3/3 steps found)
- pyruvate fermentation to ethanol II (2/2 steps found)
- pyruvate fermentation to isobutanol (engineered) (4/5 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- acetaldehyde biosynthesis I (1/1 steps found)
- phytol degradation (3/4 steps found)
- salidroside biosynthesis (3/4 steps found)
- L-isoleucine degradation II (2/3 steps found)
- L-leucine degradation III (2/3 steps found)
- L-methionine degradation III (2/3 steps found)
- L-valine degradation II (2/3 steps found)
- ethanol degradation I (1/2 steps found)
- phenylethanol biosynthesis (3/5 steps found)
- butanol and isobutanol biosynthesis (engineered) (5/8 steps found)
- L-phenylalanine degradation III (2/4 steps found)
- L-tyrosine degradation III (2/4 steps found)
- 1,3-dimethylbenzene degradation to 3-methylbenzoate (1/3 steps found)
- 1,4-dimethylbenzene degradation to 4-methylbenzoate (1/3 steps found)
- 3-chlorotoluene degradation II (1/3 steps found)
- pyruvate fermentation to ethanol I (1/3 steps found)
- pyruvate fermentation to ethanol III (1/3 steps found)
- toluene degradation to benzoate (1/3 steps found)
- (S)-propane-1,2-diol degradation (2/5 steps found)
- acetylene degradation (anaerobic) (2/5 steps found)
- ethanolamine utilization (2/5 steps found)
- β myrcene degradation (1/4 steps found)
- cytidine-5'-diphosphate-glycerol biosynthesis (1/4 steps found)
- heterolactic fermentation (11/18 steps found)
- serotonin degradation (3/7 steps found)
- geraniol and nerol degradation (2/6 steps found)
- mixed acid fermentation (9/16 steps found)
- m-cresol degradation (1/5 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (11/19 steps found)
- limonene degradation IV (anaerobic) (2/7 steps found)
- salicin biosynthesis (1/6 steps found)
- superpathway of fermentation (Chlamydomonas reinhardtii) (3/9 steps found)
- superpathway of Clostridium acetobutylicum solventogenic fermentation (5/13 steps found)
- superpathway of N-acetylneuraminate degradation (11/22 steps found)
- noradrenaline and adrenaline degradation (4/13 steps found)
- superpathway of Clostridium acetobutylicum acidogenic and solventogenic fermentation (6/17 steps found)
- salicortin biosynthesis (1/11 steps found)
- 2,5-xylenol and 3,5-xylenol degradation (2/13 steps found)
- L-tryptophan degradation V (side chain pathway) (1/13 steps found)
- toluene degradation IV (aerobic) (via catechol) (1/13 steps found)
- superpathway of aerobic toluene degradation (1/30 steps found)
KEGG Metabolic Maps
- 1- and 2-Methylnaphthalene degradation
- 3-Chloroacrylic acid degradation
- Biphenyl degradation
- Caprolactam degradation
- Drug metabolism - cytochrome P450
- Fatty acid metabolism
- Glycine, serine and threonine metabolism
- Glycolysis / Gluconeogenesis
- Limonene and pinene degradation
- Metabolism of xenobiotics by cytochrome P450
- Phenylalanine metabolism
- Retinol metabolism
- Toluene and xylene degradation
- Tyrosine metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.1.1.1, 1.1.1.90
Use Curated BLAST to search for 1.1.1.1 or 1.1.1.144 or 1.1.1.347 or 1.1.1.90
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (374 amino acids)
>mRNA_1713 KOG0022 Alcohol dehydrogenase, class III (Rhodosporidium toruloides IFO0880) MKTQAYVLAEKDAPFKLQEVELAEPEDNEVFLEVVACGLCHTDLCIQNGAFPSPFPNVTG HEGSGRVLKVGKAVTRVQPGDKVLCSFNHCSSCGPCQTGHPAACEKFGEINFGRVRGAET GNKAGIKGAGGEEIYGAFFGQSMFAKHALVAEKSVVKVPDDTDLVTLSALGCGFQTGAGG VLNFLKPSKDSSIAISGLGAVGMGALFAAKYLGTKTIVALDVVPGKLDLAKQFGATHAFN ARHSDVVQQVKDITAYKGGVQYFAECSGNVPALKAAWEMTANRGHLLSCGTPGPGVNPPF DVFGNLVACKTYSGLCEGDSNPPKFIPFLIKLYNEGHFPVDKISKTFAHDKLDDAIHAMH KGETIKPIVVFGQA