Protein Info for mRNA_1775 in Rhodosporidium toruloides IFO0880

Name: 10143
Annotation: KOG1289 Amino acid transporters

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 transmembrane" amino acids 57 to 78 (22 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 142 to 168 (27 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 250 to 270 (21 residues), see Phobius details amino acids 283 to 311 (29 residues), see Phobius details amino acids 338 to 363 (26 residues), see Phobius details amino acids 384 to 406 (23 residues), see Phobius details amino acids 412 to 436 (25 residues), see Phobius details amino acids 456 to 478 (23 residues), see Phobius details amino acids 485 to 505 (21 residues), see Phobius details PF13520: AA_permease_2" amino acids 56 to 493 (438 residues), 154.9 bits, see alignment E=3.1e-49 PF00324: AA_permease" amino acids 72 to 516 (445 residues), 54.4 bits, see alignment E=8.6e-19

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (528 amino acids)

>mRNA_1775 KOG1289 Amino acid transporters (Rhodosporidium toruloides IFO0880)
MATVRSLDSTKSRTMSNEGVGPAKQELRSKVLAVGGIAGTYEELTGHKQELKVSMSVWAL
LGLAFANMAPSTAINGSLGTALLSGGPVASLWGWLAVALISICIALSLAELCSAWPHAAG
QALWSFQLAPPRWAPFLSYWTAWWNIAGGWALIAAGAYILSAGCLGLAAAYHPDYVEQPW
HLVVCFLFSLFLFFLYMVRILDRCTTSFAIINISTVVATIIALAACAPVKAKPSFVFGGF
YNGTGWSNGGLVFLLGLLQSSFTIIGYDAATHLCEEAVDAGRLAPIAVVGGTVIVGVVGF
CYIIALLFAIADIDTVVSSPLPIVQILSDSFGLRGATAAFVFNLLILSFACIGIVCASSR
AVWSMSRDRGFPGSLFFGKVNQTFVVPVNALLLQVTVPAILGLIYLGSNVVFFAFFQLTT
IGYLISYFIPIALIFFRGRHLLPPAYWRMPDGLARFCNIVALLYIPFICVLFCIPNFYPV
TSTNMNYTSAIAAVAILIGTIGWYVEVRRHYKGPASQAPHLEETVAAV