Protein Info for mRNA_1785 in Rhodosporidium toruloides IFO0880

Name: 10153
Annotation: K04077 groEL, HSPD1 chaperonin GroEL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 557 TIGR02348: chaperonin GroL" amino acids 27 to 541 (515 residues), 716.6 bits, see alignment E=8e-220 PF00118: Cpn60_TCP1" amino acids 46 to 540 (495 residues), 305.3 bits, see alignment E=3.8e-95

Best Hits

Swiss-Prot: 76% identical to HSP60_EMENI: Heat shock protein 60 (hsp60) from Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139)

KEGG orthology group: K04077, chaperonin GroEL (inferred from 81% identity to uma:UM05831.1)

MetaCyc: 55% identical to chaperonin GroEL (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family chaperone GroEL" in subsystem GroEL GroES or Staphylococcal pathogenicity islands SaPI

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (557 amino acids)

>mRNA_1785 K04077 groEL, HSPD1 chaperonin GroEL (Rhodosporidium toruloides IFO0880)
MLRTSHAARRAIPGIHTQVSARRFAHKELKFGNDGRQALLAGVDILAKAVSVTLGPKGRN
VIIEQPFGGPKITKDGVTVAKSISLKDKFENLGARLIQDVASKANEEAGDGTTTATVLAR
AIYSEGVKNVAAGCNPMDLRRGTQAAVEAVLKFLEANKRAITTSSEIAQVATISANGDEH
VGNLIAQAMEKVGKEGVITVKEGKTIEDEIEVTEGMRFDRGYISPYFVTDVKSQRVEFEK
PLILLSEKKISLIQDILPALETAAQARRPLLIIAEDIDGEALAACILNKLRGQLQVAAVK
APGFGDNRKSILGDLAILTGSTVFTDELDIKLEKLSPDMLGTTGSVTITKEDTIVLNGAG
DKTLIQERCEQIRSAMNDPSTSDYDRTKLQERLAKLSGGVAVIRVGGSSEVEVGEKKDRY
DDALNATRAAVEEGIVPGGGTALLKASRVLDEVPHDNLFDRKLGINIIRQALTKPARTIA
ENAGEEGSVVVGQLLEKYSGDFEMGFDASKGTYVNMIQAGILDPLKIVKNSLVNASGVAS
VSPFVRSSAHALLALRG