Protein Info for mRNA_1816 in Rhodosporidium toruloides IFO0880

Name: 10184
Annotation: K08178 JEN MFS transporter, SHS family, lactate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 488 transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 104 to 122 (19 residues), see Phobius details amino acids 128 to 151 (24 residues), see Phobius details amino acids 164 to 184 (21 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 254 to 272 (19 residues), see Phobius details amino acids 292 to 315 (24 residues), see Phobius details amino acids 323 to 341 (19 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 24 to 239 (216 residues), 82.4 bits, see alignment E=3.5e-27 PF07690: MFS_1" amino acids 45 to 374 (330 residues), 86.6 bits, see alignment E=1.7e-28

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (488 amino acids)

>mRNA_1816 K08178 JEN MFS transporter, SHS family, lactate transporter (Rhodosporidium toruloides IFO0880)
MGVFSAFIENLPRPPPKSSRESTNVIAIFRSLTFMQYMLFFSGWLAWTVDAIDYFSVSLS
NHSLSIYFGKPLKTITTSLTLTLLFRPLGAVIFGLLSDRYGRRWPLILDLLICGALSLST
AYCKTFGAFLAVRSLFGIAMGGIWGLSAALGLENMPVEARGMFSGILQQGYAVGYLLAAV
INLTLVPKHHNNYRILFYFAAAVSAFAAIVRACLPESEYFLKRREAEKASGNVVSSAEKS
KIFIKEAGRALKLHWVRCIFALCLMTGFNFFSHGSQDIYPSYMQDSKGLSAHQATIATII
GNCGAIAGGTIAGYVSQFLGRRLTIIVCCLWTCAFIPLWLIPKSFGGLAAGAFMVQMGVQ
GVAYQLGNMVSSASAQIEATAGANLKTASGKPAYGKVGAILIGVVAAWIIGCCLLGREQL
GLHFEKGKAAFEKGGGRDEIEELDEDAMDPHAHHDIEKAPEHNKLGQPLHRESASMTDEK
ASNISSAY