Protein Info for mRNA_1821 in Rhodosporidium toruloides IFO0880

Name: 10189
Annotation: HMMPfam-Domain of unknown function (DUF2427)-PF10348,HMMPfam-Protein of unknown function (Ytp1)-PF10355

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 617 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 133 to 155 (23 residues), see Phobius details amino acids 162 to 183 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 366 to 388 (23 residues), see Phobius details amino acids 398 to 415 (18 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details amino acids 498 to 521 (24 residues), see Phobius details amino acids 537 to 559 (23 residues), see Phobius details amino acids 571 to 593 (23 residues), see Phobius details PF10348: DUF2427" amino acids 126 to 210 (85 residues), 72 bits, see alignment E=3.2e-24 PF10355: Ytp1" amino acids 334 to 595 (262 residues), 300.1 bits, see alignment E=1.5e-93

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (617 amino acids)

>mRNA_1821 HMMPfam-Domain of unknown function (DUF2427)-PF10348,HMMPfam-Protein of unknown function (Ytp1)-PF10355 (Rhodosporidium toruloides IFO0880)
MRAAVLVLLTATATLALPSVSSSLTQDLARRRSANALHLEGLVPRHGDDEDEDTGAMIDA
QAMTSGHSAHDDTAAPASSVEAGGHSHGDEHAHGHSHAKPLLELNETQILLTHSPDPPSY
WDFDHSDEGKPAVLYVHIALMTLAFFVLLPLALFLKAGRSALSIIPQTGFLVTSVLGLFF
GQVYNGLTPDMYKGSSHTTWGWITMVLAVALNILDVGRFVLRFTRWGNKLDAKLAGLSMS
EQYEKDERSVFQLGADEDEGDEAERLVSSPVALHHSVPSPTRGNSLSFSDEDTAVHSDEV
DWREPARPKSARQKVRRYLGLAADFAERMLVLLAYVEVCTGVAVYTGTCRENYLNGCLAH
IIKGSIFVWYGLLSFARYCGAFSSLGWAWNRHPARNNSIWTAEFVESLVIFVYGSTNTWM
ERMGKTGAYSIKDIQHISIAVMFWGAGALGMVLESRTIRSWLATPAAQASGRSLDEIPPP
PSAAASFNPFPAIAIVEVHALWGLLLGCFSLFRFLTYFFTYLRPPASILPSRPPTEALAS
LCLTAGGVVFILSTEQVTFAAMRHNADDVMAFLNLTIAAVCVWFFWIAALFAVKGWALGR
STPQSSATLRAKAVVSP