Protein Info for mRNA_1832 in Rhodosporidium toruloides IFO0880

Name: 10200
Annotation: K11188 PRDX6 peroxiredoxin 6, 1-Cys peroxiredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00578: AhpC-TSA" amino acids 11 to 147 (137 residues), 117.2 bits, see alignment E=6.8e-38 PF08534: Redoxin" amino acids 12 to 146 (135 residues), 52.7 bits, see alignment E=6.3e-18 PF10417: 1-cysPrx_C" amino acids 168 to 205 (38 residues), 47.3 bits, see alignment 2.3e-16

Best Hits

Swiss-Prot: 52% identical to PRX1_YEAST: Peroxiredoxin PRX1, mitochondrial (PRX1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 64% identity to uma:UM06404.1)

MetaCyc: 49% identical to peroxiredoxin-6 monomer (Homo sapiens)
RXN-20693 [EC: 1.11.1.27]

Predicted SEED Role

"Alkyl hydroperoxide reductase subunit C-like protein" in subsystem Oxidative stress or Rubrerythrin or Thioredoxin-disulfide reductase

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (220 amino acids)

>mRNA_1832 K11188 PRDX6 peroxiredoxin 6, 1-Cys peroxiredoxin (Rhodosporidium toruloides IFO0880)
MAAQKTGTRLGYLAPDFEAQTTQGKIRFHEFIDGKWTILFSHPADFTPVCTTELAEAARL
APEFQKRGVQMIGLSCNELGSHSKWIEDINKFGSVDVQFPIIADPSREVAKLYDMLDEQD
LTNLDEKGVPFTVRTVFIIDPKKTIRLSLQYPASTGRQFNEILRCIDSLQLGDKNKITTP
ANWQPGEKVIVHPSVKTEDARKIFPNEVQEVYPYLRFTQL