Protein Info for mRNA_1842 in Rhodosporidium toruloides IFO0880

Name: 10210
Annotation: K08660 CNDP2 cytosolic nonspecific dipeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 PF01546: Peptidase_M20" amino acids 93 to 468 (376 residues), 127.3 bits, see alignment E=7.1e-41 PF07687: M20_dimer" amino acids 208 to 366 (159 residues), 38.2 bits, see alignment E=1.2e-13

Best Hits

Swiss-Prot: 58% identical to CNDP2_MOUSE: Cytosolic non-specific dipeptidase (Cndp2) from Mus musculus

KEGG orthology group: K08660, cytosolic nonspecific dipeptidase [EC: 3.4.13.- 3.4.13.18] (inferred from 67% identity to uma:UM02158.1)

MetaCyc: 57% identical to DUG1 (Saccharomyces cerevisiae)
Cytosol nonspecific dipeptidase. [EC: 3.4.13.18]

Predicted SEED Role

"Acetylornithine deacetylase/Succinyl-diaminopimelate desuccinylase and related deacylases"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.- or 3.4.13.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>mRNA_1842 K08660 CNDP2 cytosolic nonspecific dipeptidase (Rhodosporidium toruloides IFO0880)
MLDAPFAKWIDEHQDELIARLKEAVEIPSVSGDASYRPHVVRMGEWLKAELEKLGAEIRS
VPLGKQVLDGQELDLPPALVGSLGNDPKKKTVLVYGHYDVQPAALSDGWKHEPFQFTHDK
ETGRLYGRGSTDDKGPIMGWINAIQAFQETKTEIPVNLRFCFEGMEESGSEGLEELVIKE
AKGEFADVDAVCISDNYWLGTTTPCLTYGLRGLSYFSVSISGPAADLHSGVFGNVVHEPM
TDLFDLFSKLVTPQGKILVPGINEKVAPLTDEERKLYEDIDVTLGDFEQAIGAKVTISED
KAEVLMGRMRYPSLSIHGVEGAFSGQGGKTVIPAAVKGKFSIRLVPDLDPDEVNELVQKY
LKDEFAKLGSKNTLKVEMLSGGKPWVASIDHWNFRAAKDAIETVYGKTPSYTREGGSIPI
TLTFAEALGKNVMLLPMGRGDDGAHSTNEKLDLSNYIEGTKTLGQYLLNVPAAAASA