Protein Info for mRNA_1845 in Rhodosporidium toruloides IFO0880

Name: 10213
Annotation: K06127 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 PF01209: Ubie_methyltran" amino acids 2 to 242 (241 residues), 271.4 bits, see alignment E=1.7e-84 TIGR01934: ubiquinone/menaquinone biosynthesis methyltransferase" amino acids 6 to 242 (237 residues), 245.5 bits, see alignment E=1.9e-77 PF13847: Methyltransf_31" amino acids 43 to 164 (122 residues), 58.1 bits, see alignment E=2.8e-19 PF13489: Methyltransf_23" amino acids 47 to 222 (176 residues), 39.6 bits, see alignment E=1.5e-13 PF08241: Methyltransf_11" amino acids 49 to 156 (108 residues), 60.5 bits, see alignment E=6.4e-20 PF13649: Methyltransf_25" amino acids 49 to 153 (105 residues), 65.7 bits, see alignment E=1.6e-21 PF08242: Methyltransf_12" amino acids 49 to 155 (107 residues), 50.7 bits, see alignment E=7.9e-17

Best Hits

Swiss-Prot: 59% identical to COQ5_SCHPO: 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial (coq5) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K06127, ubiquinone biosynthesis methyltransferase [EC: 2.1.1.-] (inferred from 62% identity to lbc:LACBIDRAFT_323025)

Predicted SEED Role

"Ubiquinone biosynthesis methyltransferase COQ5, mitochondrial precursor (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>mRNA_1845 K06127 COQ5 2-methoxy-6-polyprenyl-1,4-benzoquinol methylase (Rhodosporidium toruloides IFO0880)
MKESLVKGVFSSVASSYDVMNDAMSLGIHRLWKDHYVSKLDPHGGLKCLDVAGGTGDIAM
RILDHAREKYGDRETSVSMLDINPEMLEEGKKRFAKTMYHNTPQVSFHLGNAEHLEQFAD
NSFDLYTIAFGIRNCTHPDKVVEEAYRVLKPGGVLSVLEFSNVPNPILSQAYDLWSFNVI
PALGHILASDRDSYAYLVESIRRFYKAPEFAEVIRKAGFQVAQNEPWEPLTFGIAAIHTG
VKV