Protein Info for mRNA_1857 in Rhodosporidium toruloides IFO0880

Name: 10225
Annotation: KOG2533 Permease of the major facilitator superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 597 transmembrane" amino acids 133 to 150 (18 residues), see Phobius details amino acids 203 to 222 (20 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 297 to 318 (22 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details amino acids 410 to 433 (24 residues), see Phobius details amino acids 440 to 461 (22 residues), see Phobius details amino acids 467 to 486 (20 residues), see Phobius details amino acids 506 to 524 (19 residues), see Phobius details amino acids 537 to 557 (21 residues), see Phobius details PF07690: MFS_1" amino acids 154 to 520 (367 residues), 70.4 bits, see alignment E=6.8e-24

Best Hits

KEGG orthology group: None (inferred from 51% identity to cci:CC1G_00526)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (597 amino acids)

>mRNA_1857 KOG2533 Permease of the major facilitator superfamily (Rhodosporidium toruloides IFO0880)
MAPSLSNVEILPAQPRLDASPPHSPSANSLDDLKDDKVDAYGKSETSSLSSRAPLAPRAD
IASHTAGAAFLRLLGVRKRSTFDDPDAVATQESVYDGPLAAAYTPGDEYENKDAFDPSFR
WTNREEKALRRKLDFKIFLWVAIMFLALDIDRGNMANATADNLLKDLGLTHGDYNLGNTL
SKLGFLVAELPSQMIGKKIGVDIWLPTQIVVFSILSFAQFWMNGRTSFLALRFLIAAGQG
GFIPDVILYLSYFYTKSELVTRLACFYTINFSSGTLTAFLAVGLLKMRGVGGYAGWRWMF
LIEGLLTLVVGIASYFLLAPSPSQTKTKWRPNGYFTDREVKIIVNKVLRDDPTKASMHNR
QALTPKLLWKSACDYDLWPMYLLGLTFGIPGNPISYYFQISMKSLGFSTVMANVLAVPNT
LISIVTLLLLAIASELTNNRWAICAIQNVWFVACLIPLRVLPDPISPWTYFALATVLLGS
PYAHSVQVTWCSRLAGSVRTRTFSASLYNMAVQTSSIIGANIYQASDAPRYKRGNTILLA
IAAWNLVVMYPGIFLYYRARNAYKERKWNAMSVEEQKHYLETTSDEGCKRLDFRFVY