Protein Info for mRNA_1860 in Rhodosporidium toruloides IFO0880

Name: 10228
Annotation: K02259 COX15 cytochrome c oxidase assembly protein subunit 15

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 531 transmembrane" amino acids 139 to 158 (20 residues), see Phobius details amino acids 221 to 239 (19 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 349 to 375 (27 residues), see Phobius details amino acids 425 to 441 (17 residues), see Phobius details amino acids 462 to 480 (19 residues), see Phobius details amino acids 486 to 506 (21 residues), see Phobius details PF02628: COX15-CtaA" amino acids 138 to 499 (362 residues), 327.8 bits, see alignment E=3.5e-102

Best Hits

Predicted SEED Role

"Heme A synthase, cytochrome oxidase biogenesis protein Cox15-CtaA" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (531 amino acids)

>mRNA_1860 K02259 COX15 cytochrome c oxidase assembly protein subunit 15 (Rhodosporidium toruloides IFO0880)
MASHAVWRPLAGAAASSARLAASKSTPTPAIAHFARSRAGVQAWETAAVTRRLCSAGAGQ
ARTAVAGGSFAGSRVFAALQQPRTTSFAASPLAALRQNVARSARALTTAAIDSTSSGSSS
STFPDPPEVPLTSPLVSRYLFVIGGLVFAIVVVGGMTRLTESGLSITEWNVIKGVKLPMS
QAEWEEEFEKYKLTPEWKINNQHITLQDFKTIYMWEWSHRILGRIIGVAFLAPIPYFVYA
RKLGRGALFALFGIASLIGAQGAMGWYMVKSGLDEQSVQDLGGVPRVSQYRLAAHLGLAF
LVYSACVRFGIGAARDWKLAKKMQGLGGWKTVEETIRGLEGKVAGRTRVLVTALTALVFT
TALSGAFVAGLDAGLIYNEWPLMGGKLHPPSYELNKDFYCRKADKSDRWRNLFENPTTVQ
FDHRMLAYTTFFSVVSLFLYARRPHIRSQLPPLTYRLIKGSLHMSVLQLTLGITTLLYLV
PTHLAATHQAGSLVLLSLVLAAGASLRRPSKVAREALRIAQLRQKAAQIKV