Protein Info for mRNA_1877 in Rhodosporidium toruloides IFO0880

Name: 10245
Annotation: K03363 CDC20 cell division cycle 20, cofactor of APC complex

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 PF00400: WD40" amino acids 384 to 429 (46 residues), 15.2 bits, see alignment 3.4e-06 amino acids 442 to 475 (34 residues), 14 bits, see alignment (E = 7.7e-06)

Best Hits

Predicted SEED Role

"ClpB protein" in subsystem Protein chaperones or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (599 amino acids)

>mRNA_1877 K03363 CDC20 cell division cycle 20, cofactor of APC complex (Rhodosporidium toruloides IFO0880)
MSRSPTKRRAGGVDALPLSNLSLNSASPSRQPLAKSTKQPPKSIFATAGSISTTQTTRKK
ASSSPTKGTSRSRYSGEDDLTGNLTGTYDAPSRRSSPSKQSSGSLAAGGGVGRSGVVSND
WDPSSLGGESKRSPSKKGRHYDRYIPSRQSGNGDHTGPILLPTPHSGSDSSPQNAEDAQH
TADLSRSLGINSDQRILSFFAEPPMPQTEHSSLLAQYARLPNKGSAGSSSSAAHAASRRR
IPTQPERVLDAPGMVDDYYLNVVDWSSTNLLAIGLGEVVYIWNAQTGEVNELCSVGSNSG
DSSALTEGDEYVCSLKFTEDGGHLAVGLSSGPIMVYDVCAGQRLRTLQGHPTRVPSLSWS
GAILASGCRSGEIWNSDVRIAQHNVAQLKGHRGEVCGLEWRPEIAGGLSGGGQGLLASGG
NDNVVNVWDCRMTTAPKMSKTNHTAAVKALAWCPWNSSLLASGGGSSDKTIHFWNTTQSA
RLNSLVTNSQVTSLVWNPHAKELLSTHGVPDHHIALWSYPSLSKVAEIPNAHQSRILHSS
LSPDGMTVVTASSDEDLKFWKMFEMPKGVKAGAGRSLTGKDLAENDGIGRKGKTGISVR