Protein Info for mRNA_1948 in Rhodosporidium toruloides IFO0880

Name: 10316
Annotation: K08176 PHO84 MFS transporter, PHS family, inorganic phosphate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 49 to 76 (28 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details amino acids 121 to 140 (20 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details amino acids 227 to 248 (22 residues), see Phobius details amino acids 318 to 344 (27 residues), see Phobius details amino acids 364 to 386 (23 residues), see Phobius details amino acids 416 to 436 (21 residues), see Phobius details amino acids 442 to 460 (19 residues), see Phobius details amino acids 480 to 500 (21 residues), see Phobius details amino acids 512 to 534 (23 residues), see Phobius details PF00083: Sugar_tr" amino acids 48 to 545 (498 residues), 158.4 bits, see alignment E=3e-50 PF07690: MFS_1" amino acids 91 to 496 (406 residues), 63.8 bits, see alignment E=1.5e-21

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (566 amino acids)

>mRNA_1948 K08176 PHO84 MFS transporter, PHS family, inorganic phosphate transporter (Rhodosporidium toruloides IFO0880)
MSIEGKEAAISEPSLNQQGGAVDLNARRRAALAEIDNAKFGWFHVKACAVAGVGFFTDAY
DIFAINLCAAMIGYVYNMGNHKGALTANQDLGLKIATPVGTLVGQLFFGWLADIVGRKKM
YGFELIIIIIATLGQAVAGHGPAVSIIGVLVMWRFIMGVGIGGDYPLSSVITSEFAATRI
RGRMMVATFWSQGWGQLAAAIVTIVCLAAFKKQILNDPVNYAHHLDFVWRLVIGLGAVPG
AVALYFRLTLPETPRFTMDVERNIKQAASDVDAFLQTGGYVQDSTPAVTKVAAPKATLRD
FRQHFGQWKNGKVLFGTAWSWFALDVAFYGLGLNSSIILTAIGYSAPSSGTPQHIRYYSL
YNNAVGNIIITVAGLIPGFWAAFFLIDRIGRKVFLGINTSLDGTLADRPPFSAQPLQLIG
FALLTVTLCCMGFGYHKLKDNAVGAFVFLYCITNFLQNFGPNTTTFIIPGEVFPTRYRST
AHGISAGSGKFGAIIAQIMAFKLKDRGGKNAFVPHILEIFALFMLTGIFSTLLLPETKGK
TLEELSGEDNDHFIEDTPAPHGAARV