Protein Info for mRNA_1963 in Rhodosporidium toruloides IFO0880

Name: 10331
Annotation: K00767 nadC, QPRT nicotinate-nucleotide pyrophosphorylase (carboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)
  • amino acids 27 to 310 (284 residues), 295.7 bits, E=1.4e-92
• PF02749: QRPTase_N
  • amino acids 46 to 125 (80 residues), 64.4 bits, E=8.5e-22
• PF01729: QRPTase_C
  • amino acids 127 to 309 (183 residues), 173.4 bits, E=3.6e-55

Best Hits

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 62% identity to ssl:SS1G_05542)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

• NAD biosynthesis from 2-amino-3-carboxymuconate semialdehyde (4/4 steps found)
• NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
• superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
• NAD de novo biosynthesis I (from aspartate) (4/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (4/6 steps found)
• aspartate superpathway (15/25 steps found)
• nicotine biosynthesis (1/9 steps found)
• superpathway of nicotine biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Protein Sequence (314 amino acids)

>mRNA_1963 K00767 nadC, QPRT nicotinate-nucleotide pyrophosphorylase (carboxylating) (Rhodosporidium toruloides IFO0880)
MPSAPSALPAPLGTYAHLLPPSWKTVITSWLAEDTPSFDYGGFVVGEGEEEATLWGKSEG
VLAGVPFVDEIFAQLGCTVEWHLAEGADVEPTKEMPKIKVATVRGPARCLLLGERVALNT
MARCSGIAWKSRKVLLKARQLGWNGIIAGTRKTTPGFRLVEKYGMLVGGVDPHRYDLSSM
VMLKDNHVWSKGSITEAVHAAKSTAGFALRIHVECQSLAEAREAIAAGADIIMLDNFTPQ
GIREAAAALKEDWVKQTGGQENGAAKRCLVEVSGGLTEENMEESLCPDVDILSTSAIHQG
VSTIDFSLKIQPRR