Protein Info for mRNA_1987 in Rhodosporidium toruloides IFO0880

Name: 10355
Annotation: KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 58 to 82 (25 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 150 to 175 (26 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 215 to 234 (20 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 409 to 432 (24 residues), see Phobius details amino acids 438 to 463 (26 residues), see Phobius details amino acids 484 to 502 (19 residues), see Phobius details amino acids 514 to 535 (22 residues), see Phobius details PF07690: MFS_1" amino acids 65 to 459 (395 residues), 95.5 bits, see alignment E=1.7e-31

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>mRNA_1987 KOG0255 Synaptic vesicle transporter SVOP and related transporters (major facilitator superfamily) (Rhodosporidium toruloides IFO0880)
MGLPTLLKNGEDTEMAPGTIRLFNPDGSELHSAGDMILVPTPSSHPDDPLNWSRWRKLLS
LFCVILYTFCMSVAQSALFSIYEPLSDATGISIAALNQGVGVQYLLVGFAPLITSSLGNA
FGKRPLYLVTLLISAGCCVWMANIKSRASWMVQCVVLGFSNGPTFAATEVSIAQVFFAHE
RATPMGAYVATLYGAALIAPLLGACISEGLGYKAVFYFAGIFCLGSFVFCFFFMEETNFY
RKAMSSMMERPLDKIDEEALERKPEGRGKVSLSPGEGHAKVAATSHVVEADVGRRSFVQR
LGTRVNAQPWAAFKEGFVQPLVMLQHPVVWFAALQYGIMQVWYNFLNGISADTLAAEPYS
FSVAQTGLAYLSPTAFTTPGVVLYGLLSDRFTLWMAKRNGGISEPEHKLWLMLLLFPLLP
VGLTFLGIGPYFSLPWPAFVIAGLGLTSVASSFGTTSALNYLFDSFSAYENPSSLAPPED
CPQLVSALIPAMVLSFAMNYALNPWIASMGMKDWGISCAALAVVVNLSMVPMILYGKRLR
KRQAGMLYGVGL