Protein Info for mRNA_1990 in Rhodosporidium toruloides IFO0880

Name: 10358
Annotation: HMMPfam-PPR repeat-PF01535,HMMPfam-Pentatricopeptide repeat domain-PF13812,ProSiteProfiles-Pentatricopeptide (PPR) repeat profile.-PS51375,TIGRFAM-PPR pentatricopeptide repeat domain-TIGR00756

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 769 TIGR00756: pentatricopeptide repeat domain" amino acids 390 to 423 (34 residues), 17 bits, see alignment (E = 2.4e-07) amino acids 468 to 494 (27 residues), 16.4 bits, see alignment (E = 3.7e-07) PF01535: PPR" amino acids 391 to 419 (29 residues), 10 bits, see alignment (E = 0.00014) amino acids 467 to 493 (27 residues), 18.6 bits, see alignment (E = 2.6e-07)

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (769 amino acids)

>mRNA_1990 HMMPfam-PPR repeat-PF01535,HMMPfam-Pentatricopeptide repeat domain-PF13812,ProSiteProfiles-Pentatricopeptide (PPR) repeat profile.-PS51375,TIGRFAM-PPR pentatricopeptide repeat domain-TIGR00756 (Rhodosporidium toruloides IFO0880)
MVATRLRTAAKSVTCECWRYYGTASSSSTFPIASTSRTTLDDPLPTWQDLVGSGTSDGTQ
VDSTGARQDCPLSRRATSRPPQLPPSAPSSSLSSDPNAREADAIEPIPSDAPTRPILRDK
SQISPYLPLVTLERNHLLSELRKALFPSSVHRARRRQEGMGKARPDSVWVALARVLRYPS
DLPRLPKSEYPTSTRARRRDEDEEFSQREEAEGKGEGFFTSSHPSADGQAERTLQGASHD
IHRDKIVLSLAELRRAFSIFASARPRSVTGLHRLLVVAELIAQQSMTSSAAHPISMAGLS
DDLHRLTGGGAGLRGKDWTSLVLFVGASMRTPKAEQDVGGAMALFSQWLETRQLEHQPPA
STPDSSPSPARLTHRDRKSGFRDRSAEQRLYNALLFVVGRAKMWDLFDQVLRRMKEEGFE
GDCATIVELIKREEKRAGPLLNAWRYFEQAVATPMYEEGRENEVEAVWAAMVWVYAKQGR
FEEAMRMYEAMRARATVALDDLRPSSPAAYDRDWLKQGFASSTTGVAKVPSASASTGITV
RAPPVNDRVYTSLLQAFAFRGELRSALRILRHISKSTNPAIQPAIHHFSPIFQAFANHGG
GLYGNPAASVNETLIKGTRVSQYALKRDASPLAALTQQAAAKAVRGQRGAAASPPEDPFT
LDNLATIFQSFLSISAPPSTSHPSLPYLGARTAPTARQIFWILFAFDKLSQGDSELVLEV
WDELVRKFAEEEGRRKGWTGWYMDNRVARLVRTHEQRAAERLERVKALE