Protein Info for mRNA_1991 in Rhodosporidium toruloides IFO0880

Name: 10359
Annotation: K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 51 to 68 (18 residues), see Phobius details amino acids 74 to 101 (28 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 181 to 198 (18 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 248 to 266 (19 residues), see Phobius details amino acids 287 to 312 (26 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 373 to 392 (20 residues), see Phobius details amino acids 398 to 422 (25 residues), see Phobius details amino acids 449 to 469 (21 residues), see Phobius details amino acids 481 to 500 (20 residues), see Phobius details PF02133: Transp_cyt_pur" amino acids 45 to 470 (426 residues), 295.1 bits, see alignment E=4.6e-92

Best Hits

KEGG orthology group: None (inferred from 42% identity to cne:CNM00460)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>mRNA_1991 K03457 TC.NCS1 nucleobase-cation symporter-1, NCS1 family (Rhodosporidium toruloides IFO0880)
MGLFRRRDDPQPRQPFSWVLPKQTSSLAPEDIYTNADLDPTTDPAQRTWGYGTWFSFWVA
ASLDPAFWQTGASLIPLGLSCANAIGIVILGNVIISVPIVLNGMIGANLRIPFPVAARAS
MGYWFSLFAVLSRAFLSLIWFGVETYNGGSAMTQFLRAIWPSYWNIENKLPESAGITTRD
MTSYFLFWLIQLPFFFLNPNQLRWAFMLKTVVVPVTMLATMGSLVHAAGGAGPLFHQPNL
VTGKDFSAAWLLGLASLCGNWATLAVNSPDFTRYTTTNRAQWSQAIAIPLSAFFVTICGI
LAASASIPVYGLTNDAAYWSPFDIMSQWNNRAAVAFAALAWMLAGIAANITANSISSAND
FVTLAPKYINITRGQLITAVLGGWAVAPWKILSSSGTFLTFVSGYAIFLGPLSALLTADY
FLVKRKAYHVPELYDPESIYKYTGGVNWRAALTLAVTVAPNLPGLIHAINPNVVIGNIQW
WYAPGFITGYIPALVVYYLLNLAFPHHATLLAEAVTADDVDLSVPPTIDNFGTKSDELNK
DAYEMGSVSVHA