Protein Info for mRNA_2039 in Rhodosporidium toruloides IFO0880

Name: 10407
Annotation: KOG2895 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 559 transmembrane" amino acids 95 to 112 (18 residues), see Phobius details amino acids 226 to 244 (19 residues), see Phobius details amino acids 249 to 266 (18 residues), see Phobius details amino acids 273 to 294 (22 residues), see Phobius details amino acids 300 to 320 (21 residues), see Phobius details amino acids 332 to 352 (21 residues), see Phobius details amino acids 372 to 394 (23 residues), see Phobius details amino acids 435 to 456 (22 residues), see Phobius details amino acids 463 to 483 (21 residues), see Phobius details PF10998: DUF2838" amino acids 224 to 334 (111 residues), 140.4 bits, see alignment E=1.4e-45

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (559 amino acids)

>mRNA_2039 KOG2895 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MSTPPDPAPEGMRRRTLASSTPATASSTFGLTDSPALDATASASSSPPSPALEPLTPPFR
PAFSRTNSTNGGSSSSSSSSTSNSPRFDLPEDDPLFSGLSLLDLLNVLDAHIELLTRPLR
RKSVSWKTKADRLLDEAKQRGRETFKVQLPSVPAFDLGEGLGFAAGREREREGGAASLQE
RKVLSQKDRERLERKYREVRERMRQSIAKLVVKWEEEKTVRLRDKISFVCGVMNVLISSL
LLGFEPTWIPAWYSLQMLVYTPYRVYTYKRKLYHYFLFDLCYFVNLLTIVYLWVFPGSPI
LFEACFGLTLGSLGTAIATWRNSLVFHSLDKIISLAIHIFPPFVFVVIRHFYPYDLAVAR
YPALKELPHLNPWRSMAICMVTYTVWQLLYFHFVIQLRAAKIKEGRATSFTYMVNDKKRL
IGKIAAKVPPQWREVAFMGGQAIYTFVTLLIPIFVLYDSKIWSSIYLVALFAISAYNGAS
FYMEVFARRFQKELIALRKEFDAQQQLLNRYASNPPPQTPAASTTPISDPLDAVPAPTEG
DAEAVKTTSEALGEVQKPV