Protein Info for mRNA_2121 in Rhodosporidium toruloides IFO0880

Name: 10489
Annotation: K17991 PXG peroxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 transmembrane" amino acids 189 to 208 (20 residues), see Phobius details PF05042: Caleosin" amino acids 157 to 324 (168 residues), 235.2 bits, see alignment E=2.2e-74

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>mRNA_2121 K17991 PXG peroxygenase (Rhodosporidium toruloides IFO0880)
MSPSYAQATSAWLPSDPPQPDKALLATKEEVTVGKHQHSPSTIGQDSQKVVVVAQGQGQG
ELTPPLTPPGEKEDSIAAAEGVRRRKVGKSLEEEDDDVPGKGFVQSLPGTVSAERYVPED
LDKRIYKPWVPRANIAATPEHPYGTTAGGYAEKHKDEPVLAQHVAFFDKDRDNILWPLDT
WRGFREMGYSFFWCTFAMCVIHFFFSWFTTPNRILPDPFFRVYISNGHRSKHGSDTAVFD
SEGRFIPAKFEEIFTKFDKGNKGGLTFREGVQLIHAQRQAVDPIGVAAECFEWASTYLLI
WPKDGICDKESIRTVYDGSLFYLVADAERQRSQARLAARKKMGWLEWCVDSVPGPWRGWG
KENKAGNFEWRGEVF