Protein Info for mRNA_2146 in Rhodosporidium toruloides IFO0880

Name: 10514
Annotation: K15100 SLC25A1, CTP solute carrier family 25 (mitochondrial citrate transporter), member 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 296 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 67 to 88 (22 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 270 to 292 (23 residues), see Phobius details PF00153: Mito_carr" amino acids 13 to 99 (87 residues), 66.2 bits, see alignment E=1e-22 amino acids 107 to 196 (90 residues), 64.6 bits, see alignment E=3.2e-22 amino acids 204 to 291 (88 residues), 78.9 bits, see alignment E=1.1e-26

Best Hits

Swiss-Prot: 49% identical to MTT1_USTMD: Mitochondrial tricarboxylate transporter 1 (MTT1) from Ustilago maydis

KEGG orthology group: K15100, solute carrier family 25 (mitochondrial citrate transporter), member 1 (inferred from 68% identity to uma:UM02365.1)

MetaCyc: 49% identical to mitochondrial tricarboxylate transporter 1 (Ustilago maydis)
TRANS-RXN-375

Predicted SEED Role

No annotation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (296 amino acids)

>mRNA_2146 K15100 SLC25A1, CTP solute carrier family 25 (mitochondrial citrate transporter), member 1 (Rhodosporidium toruloides IFO0880)
MSRAGKKNESPHLALVAGAFAGAVEGAATYPFEYLKTQTQFAHRTDGKPPGLWAITKQTY
ARQGILGFYSGVGALVTGNALKAGVRFVSYDRFKQMLVDRDGRLSGPRSLLAGLGAGMME
AVFAVTPSETIKTKLIDDQKREVPRYRGLVHGTVSIIKEEGFRGIYRGLGPVAARQGANS
AVRFTTYGTLKSFVSGNSRPGETLPAGVTFAIGAIAGVVTVYATMPLDVIKTRMQSLEAR
SQYRNSFHCAARIFSEEGIFRFWRGATPRLARLVLSGGIVFTVYEKVIVLIGGRAV