Protein Info for mRNA_2148 in Rhodosporidium toruloides IFO0880

Name: 10516
Annotation: KOG2490 Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 737 transmembrane" amino acids 226 to 246 (21 residues), see Phobius details amino acids 250 to 265 (16 residues), see Phobius details amino acids 363 to 386 (24 residues), see Phobius details amino acids 392 to 411 (20 residues), see Phobius details amino acids 436 to 461 (26 residues), see Phobius details amino acids 483 to 504 (22 residues), see Phobius details amino acids 557 to 576 (20 residues), see Phobius details amino acids 618 to 642 (25 residues), see Phobius details PF05346: DUF747" amino acids 279 to 641 (363 residues), 379.6 bits, see alignment E=8e-118

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (737 amino acids)

>mRNA_2148 KOG2490 Predicted membrane protein (Rhodosporidium toruloides IFO0880)
MAGLPSLSRSLPDLTLAGASLEDDLAEYDYAHTSLPSPPRSPSPPPLQPLVNGDTGSHNE
GGHVLLDSPEPLHTQLPSALRAEADYGREDGPAPNGVKWKERLEEQANGHDTPRTERSMS
IGSIHSAPEFVAAPPSPTPSASTPLAREAEDGSDTSPGPARVRRSVSSERLEEVTGRRRK
SLKRLPHTLWDYLQEEIFAVELDGEEGIKSERVTNFFAVPRELEKIILFGVFICLDSFLY
TFTILPLRAITAFRQLVANLFHNLFLSRRSGGRKRHLRLSHKCDLTKVAILSGTLFLLHR
VTDASKMYHGVRGQETIKLYVLFNVLEIADRLCCSFGQDLQDSLFSHQTFGRRTDGSHPH
IRPVALFALNLVYVVAHSLVLFYQLVTLNVAINSYSNALLTLLLSNQFVEIKGSVFKKFE
KENLFQLTCADIVERFQLALMLFIIALRNLIELSSASSSSLFSFLPASFRSVSLTLPSLP
TLSLLQAIFSPAVVVLVSECFVDWLKHAFITKFNHIRPGVYGRFVDVLCKDLVAGAGSKR
ANEQPFVDQSPFVARRLGFAALPLGCLVVRVISQAFEMLADDSAVDECAPSRMSSAIGLR
GIVAAVKEEDWVARVGSWAVVALTVFVVWICLVALKLLIGYANFRRSDRPYRLRFSSRRI
NLRAFASERWSTMLEREEEERLNDRQRPKIGVTAKEAEMDRQVASLLADDVFDSAYRNRK
INLTSLTRYDMVKSRLW