Protein Info for mRNA_2159 in Rhodosporidium toruloides IFO0880
Name: 10527
Annotation: K03263 EIF5A translation initiation factor 5A
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 75% identical to IF5A_CANAL: Eukaryotic translation initiation factor 5A (ANB1) from Candida albicans (strain SC5314 / ATCC MYA-2876)
KEGG orthology group: K03263, translation initiation factor 5A (inferred from 81% identity to ppl:POSPLDRAFT_134849)Predicted SEED Role
"Eukaryotic translation initiation factor 5A" in subsystem Translation initiation factors eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (159 amino acids)
>mRNA_2159 K03263 EIF5A translation initiation factor 5A (Rhodosporidium toruloides IFO0880) MSDDEQHQQTFEQASAGASATFPMQCSALRKNGHVVIKGRPCKIVDMSTSKTGKHGHAKV HLVAIDIFTGKKLEDLSPSTHNMDVPNVVRNEYQLMNIDDGFLNLLTADGGEKNDVKVPE GEIGDQIQAAFDNGDDIMVTVTSAMGEEHCLGWKPAPKS