Protein Info for mRNA_2173 in Rhodosporidium toruloides IFO0880

Name: 10541
Annotation: K03950 NDUFA6 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05347: Complex1_LYR
  • amino acids 24 to 84 (61 residues), 38.4 bits, E=1.1e-13
• PF13233: Complex1_LYR_2
  • amino acids 26 to 87 (62 residues), 22.5 bits, E=1.6e-08

Best Hits

Swiss-Prot: 39% identical to NDUA6_BOVIN: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (NDUFA6) from Bos taurus

KEGG orthology group: K03950, NADH dehydrogenase (ubiquinone) 1 alpha subcomplex 6 [EC: 1.6.5.3 1.6.99.3] (inferred from 52% identity to cne:CNA05580)

MetaCyc: 39% identical to NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6 (Homo sapiens)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3, 1.6.99.3

Use Curated BLAST to search for 1.6.5.3 or 1.6.99.3

Protein Sequence (130 amino acids)

>mRNA_2173 K03950 NDUFA6 NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6 (Rhodosporidium toruloides IFO0880)
MTTIPSRLARVTQQSGSWDAARARTRSLYRQWYRAAPEIVSLYSLNVPAYSIRAKIREEF
ERHREVTDLSAVDILLLKSYQDLQEALNCWKMDSHIMRWFSKEELPPRPNSFLESFYLSR
DDSKEVQPTA