Protein Info for mRNA_2186 in Rhodosporidium toruloides IFO0880

Name: 10554
Annotation: K06316 RFT1 oligosaccharide translocation protein RFT1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 36 to 55 (20 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details amino acids 175 to 197 (23 residues), see Phobius details amino acids 331 to 351 (21 residues), see Phobius details amino acids 371 to 392 (22 residues), see Phobius details amino acids 404 to 426 (23 residues), see Phobius details amino acids 433 to 454 (22 residues), see Phobius details amino acids 474 to 492 (19 residues), see Phobius details PF04506: Rft-1" amino acids 5 to 491 (487 residues), 353.3 bits, see alignment E=2.5e-109 PF13440: Polysacc_synt_3" amino acids 33 to 279 (247 residues), 33 bits, see alignment E=3.9e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (500 amino acids)

>mRNA_2186 K06316 RFT1 oligosaccharide translocation protein RFT1 (Rhodosporidium toruloides IFO0880)
SSALGAGASLFVLQLGSRLFSFALNQLLLRSTAPQAFGIATIQLDTLMATVLFLVREGIR
GAVVRTRKADTPNAVILQRQALLLPTLFSPLAALAFFLYSRFVVPTPHPAYYKTTLALYG
LSTLAELVFEPLYLRTLQDWQTITSKRVKVEGLAMLTKAIGTLVTVRLVSEDEALLGYGI
GQLVYSLTIWAGLAWILRSSTSTQSPSLSLRKVDGRFFDQGITELGWVLTKQSVVKQLLT
EADKLAIGRFGSTADMGGYAVALNYGSFVARLLFQPLEESSRLYFSSLASTSVHESASSP
QKAAASTARPATKPARPPLPALASAASYLRLLLLLYTHLTLIFIFLAPAYTTPLLHLLLG
PRWSRTSASPILRTYALSLPFLAFNGLTEAFFQSVAPAHWIQRGAAWMVVCAAGFAVSVW
VTIGRWGMGAEGLVVANCVNMAMRTAFSTVFMVRYFGQGRQKERRRIADNLKWRAWTPSV
ATVVVFVAGGIVCRRSEAVW