Protein Info for mRNA_2202 in Rhodosporidium toruloides IFO0880

Name: 10570
Annotation: K00365 uaZ urate oxidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03383: urate oxidase
  • amino acids 5 to 303 (299 residues), 294.4 bits, E=4.5e-92
• PF01014: Uricase
  • amino acids 8 to 133 (126 residues), 117.9 bits, E=1.9e-38
  • amino acids 149 to 297 (149 residues), 92.5 bits, E=1.4e-30

Best Hits

KEGG orthology group: K00365, urate oxidase [EC: 1.7.3.3] (inferred from 48% identity to uma:UM00672.1)

Predicted SEED Role

No annotation

MetaCyc Pathways

• superpathway of purines degradation in plants (14/18 steps found)
• ureide biosynthesis (5/7 steps found)
• urate conversion to allantoin I (1/3 steps found)

KEGG Metabolic Maps

• Caffeine metabolism
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.7.3.3

Protein Sequence (309 amino acids)

>mRNA_2202 K00365 uaZ urate oxidase (Rhodosporidium toruloides IFO0880)
MVHLAVAKYGKAAVRVSRIVRHPDGKHDFVEYIVRCLVEGDVARAWTHSDNAPIVATDSI
KNTVNIFAKTSPHVLQPESFALHLGLHFVTKYAHLSRCSVDIVQLKWSRIQVNGQPHKHS
FVRDGDEKRTVSVVIDATKGKNALTATCQGGITGLLCLKTTESAFEGYVFDEYTTLKPVD
DRIFSTAVDCTYTIPISPSALSISALPKLGIDFDKIYKSVVDTTLEIFATHNSASVQATL
YNMCEKVLNDNKEVSDIKYELPNKHYIAPDLSFFKLKNTDPKDAEVFTPVDAPSGHIIGL
VTREPKAKL