Protein Info for mRNA_2204 in Rhodosporidium toruloides IFO0880

Name: 10572
Annotation: K03786 aroQ, qutE 3-dehydroquinate dehydratase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01220: DHquinase_II
  • amino acids 33 to 167 (135 residues), 157.4 bits, E=9.1e-51

Best Hits

Swiss-Prot: 47% identical to AROQ_CARHZ: 3-dehydroquinate dehydratase (aroQ) from Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901)

Predicted SEED Role

"3-dehydroquinate dehydratase II (EC 4.2.1.10)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) or Quinate degradation (EC 4.2.1.10)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (16/18 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• superpathway of L-tryptophan biosynthesis (12/13 steps found)
• chorismate biosynthesis I (7/7 steps found)
• superpathway of L-phenylalanine biosynthesis (9/10 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• gallate biosynthesis (2/3 steps found)
• quinate degradation I (2/3 steps found)
• quinate degradation II (2/3 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (28/59 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (4/35 steps found)
• superpathway of aromatic compound degradation via 2-hydroxypentadienoate (5/42 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.10

Use Curated BLAST to search for 4.2.1.10

Protein Sequence (184 amino acids)

>mRNA_2204 K03786 aroQ, qutE 3-dehydroquinate dehydratase II (Rhodosporidium toruloides IFO0880)
MPTEFTTTPAGVRRITKVDPSEALDKPNDPKTFLLLSGVNHALFGKRDAKQYGTTTLAQI
EERVTKLGKELGVEIVCAQTDYEGEMCQLIHYSRCLGGVIMNPGAWAHYSYALRDAIDAC
DSPVIEVHISNVYAREEFRHKSVTAPVVKGYIAGCGILGYDLGLRTAIERRRERDAEVTA
AKQK