Protein Info for mRNA_2228 in Rhodosporidium toruloides IFO0880

Name: 10596
Annotation: K14191 DIM1 18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 PF00398: RrnaAD" amino acids 40 to 265 (226 residues), 219.5 bits, see alignment E=6.9e-69 TIGR00755: ribosomal RNA small subunit methyltransferase A" amino acids 41 to 311 (271 residues), 256.1 bits, see alignment E=1.7e-80 PF13649: Methyltransf_25" amino acids 68 to 137 (70 residues), 30.3 bits, see alignment E=8.6e-11 PF08241: Methyltransf_11" amino acids 69 to 136 (68 residues), 25.5 bits, see alignment E=2.6e-09

Best Hits

Swiss-Prot: 66% identical to DIM1_SCHPO: Dimethyladenosine transferase (dim1) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K14191, 18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase [EC: 2.1.1.183] (inferred from 70% identity to ppl:POSPLDRAFT_97193)

Predicted SEED Role

"SSU rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))-dimethyltransferase (EC 2.1.1.182)" (EC 2.1.1.182)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.182 or 2.1.1.183

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (321 amino acids)

>mRNA_2228 K14191 DIM1 18S rRNA (adenine1779-N6/adenine1780-N6)-dimethyltransferase (Rhodosporidium toruloides IFO0880)
MPRATSERFNRQHQTAPSAASKQDRQAGGKGALNPIFNTAQFGQHILKNPLVAQGIVDKA
NLRPSDVVLEVGPGTGNLTVRILEKCKQCTAVEMDPRMAAELTKRVQGKPEQRKLNIIVG
DFVKTDLPYFDVCISNTPYQISSPIVFKLLSQRPIFRVAILMFQREFAMRLVARPGDSLW
NRLSVNVQLYAKVDHIMKVGRNNFRPPPLVESSVVRIVPLDPPPPVAFAEFDGLTRIAFS
RKNKVIRANFQAKGVEQMLEANYKALCAQQEKMIPDDFDVGKLLDQVLTESGFAESRASK
MDVDDFLKLLTCFHKHGMHFA