Protein Info for mRNA_2236 in Rhodosporidium toruloides IFO0880

Name: 10604
Annotation: KOG3098 Uncharacterized conserved protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 453 transmembrane" amino acids 26 to 48 (23 residues), see Phobius details amino acids 69 to 87 (19 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 120 to 146 (27 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 223 to 241 (19 residues), see Phobius details amino acids 261 to 278 (18 residues), see Phobius details amino acids 290 to 308 (19 residues), see Phobius details amino acids 337 to 356 (20 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details amino acids 401 to 420 (20 residues), see Phobius details PF05978: UNC-93" amino acids 63 to 156 (94 residues), 35.7 bits, see alignment E=3.7e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (453 amino acids)

>mRNA_2236 KOG3098 Uncharacterized conserved protein (Rhodosporidium toruloides IFO0880)
MNDIDAARVAEELPPLPHRSRLQRLYASPVVQVFLTSAICFCTPGIFNANSGVGGGGQVN
PKTANDANVALYACFAVVGFASGSIINRIGARLAFSIGASGYALYMGSLLSYNINGNRGF
VVAAGALLGVCAGLLWTAQGSLMLAYGTEQTKGRLTWNSTSNTVGNSVYIVFLVIAACGS
FLPLLLVDPATMVRSDGTRVIPPVHPTWKKEVVGMWQLMRKEVVLVFLLPLFFSSNFGYT
WQQNSFNGALFTLRTRSLNSFLFWSCQMVGAGIFGILIDLKRFRRKSRAWVALVVLLAFH
CAVWGSGYRYQKDYYRTPDGASVPRIDLRDAGYGGRAALYVFMGILDAITQNYAYWLMGA
IFNQPASLARLVGVYKAIQSAGAAGAFAMDSAETAYMSELAATWAVCVAGLVFCIPVLLF
RLKDHTGDELVVEVGSHDAASSTSEKKADEAEL