Protein Info for mRNA_2253 in Rhodosporidium toruloides IFO0880

Name: 10621
Annotation: HMMPfam-Staphylococcal nuclease homologue-PF00565,ProSiteProfiles-Thermonuclease domain profile.-PS50830,SMART-Staphylococcal nuclease homologues-SM00318,SUPERFAMILY--SSF50199

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 transmembrane" amino acids 40 to 58 (19 residues), see Phobius details PF00565: SNase" amino acids 122 to 232 (111 residues), 85.1 bits, see alignment E=2.3e-28

Best Hits

Swiss-Prot: 45% identical to LCL3_MAGO7: Probable endonuclease LCL3 (LCL3) from Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958)

KEGG orthology group: None (inferred from 45% identity to mgr:MGG_04702)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (251 amino acids)

>mRNA_2253 HMMPfam-Staphylococcal nuclease homologue-PF00565,ProSiteProfiles-Thermonuclease domain profile.-PS50830,SMART-Staphylococcal nuclease homologues-SM00318,SUPERFAMILY--SSF50199 (Rhodosporidium toruloides IFO0880)
MFGSSESSSTTPRRKPADPPTPSAWQTLLDACARPEPSNPLLVGAATAGLLLASNRIWHR
YGRRIRNVDELAPTDFAPRRLRGVVTSVGDADNFRLYHRPALRPWSRPPTKRPDLKGETL
HVRLAGIDAPELAHFGRPSQPYSQEALEWLTATVMGKRLLVELHQKDQYGRVVGMAYVRV
FPWLRRRNVSAMMLEAGFATVYESAGAVHAGQLDRFRALEANAKSKRKGMWVQSARAYES
PAAYKQRFRSP