Protein Info for mRNA_2267 in Rhodosporidium toruloides IFO0880

Name: 10635
Annotation: K15110 SLC25A21, ODC solute carrier family 25 (mitochondrial 2-oxodicarboxylate transporter), member 21

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 274 to 294 (21 residues), see Phobius details PF00153: Mito_carr" amino acids 8 to 102 (95 residues), 86.2 bits, see alignment E=6.1e-29 amino acids 115 to 197 (83 residues), 61.7 bits, see alignment E=2.6e-21 amino acids 203 to 296 (94 residues), 61.3 bits, see alignment E=3.4e-21

Best Hits

Swiss-Prot: 55% identical to ODC2_YEAST: Mitochondrial 2-oxodicarboxylate carrier 2 (ODC2) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: K15110, solute carrier family 25 (mitochondrial 2-oxodicarboxylate transporter), member 21 (inferred from 76% identity to uma:UM04988.1)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (303 amino acids)

>mRNA_2267 K15110 SLC25A21, ODC solute carrier family 25 (mitochondrial 2-oxodicarboxylate transporter), member 21 (Rhodosporidium toruloides IFO0880)
MAQQERKPLPFAYQFLAGAIAGVTELLCLYPLDVVKTRMQLQVGKAVPGAEHYDGMVDCF
RKIIAKEGAGRLYRGLVPPLMLEAPKRAVKFAANDFWGKTFKQTFGVDKMTQSLSILTGC
SAGATESVVVVPFELVKIRLQDKNSTYKGPMDVVAQIVKKDGPLGLYAGLEPTFWRHVMW
NGGYFGCIFQVRALLPKAETKSAQLFNDFVSGAVGGFVGTAFNTPFDVVKSRVQNSVKVA
GQVPKYNWTFPSLLLIAREEGVGALYSGFLPKVLRLAPGGGVLLLVVEFTLGIFRKQLGP
PYI