Protein Info for mRNA_2273 in Rhodosporidium toruloides IFO0880

Name: 10641
Annotation: K14787 MRD1, RBM19 multiple RNA-binding domain-containing protein 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 822 PF00076: RRM_1" amino acids 310 to 380 (71 residues), 65.6 bits, see alignment E=2.8e-22 amino acids 491 to 554 (64 residues), 27.5 bits, see alignment 2.3e-10 amino acids 609 to 683 (75 residues), 27.6 bits, see alignment E=2e-10 amino acids 717 to 784 (68 residues), 66.6 bits, see alignment E=1.4e-22 PF13893: RRM_5" amino acids 702 to 790 (89 residues), 14.1 bits, see alignment E=2.9e-06

Best Hits

Predicted SEED Role

"Phytoene desaturase, pro-zeta-carotene producing (EC 1.-.-.-)" in subsystem Carotenoids (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (822 amino acids)

>mRNA_2273 K14787 MRD1, RBM19 multiple RNA-binding domain-containing protein 1 (Rhodosporidium toruloides IFO0880)
MDTRQLTRVVFTNLHPSLDANHLRTHIQRCPPTTPAITDLKVLARPDGSSRCIAFAGFSS
HDDADRVRQWASGAWLAGARGGARVKTDWAKSVQRLPNALLTPSTPAQTREAPRPAKRPR
LAGQAPDGQVLQAAGKKADRFTEFLAVMTGRDSVQPVAAVGATEPSTPLAIEPTTTDQRA
LDTPPDDPTQGIRGPERLDEPAQLRESTPDDGAAQDESLTDEQYLAKRLKRTIDVVEPDD
DAQQSKRPFSQDELVADTETKSGEQGSDQVRQDRQHSLPTSSLTLSPASRLRRQPVHRDE
DEVIAETGRLFVRNLPFAATQADLEQLFEHYGPLEQVHIPRDPSTSTPRGIAYITFSQPQ
HALEARAALDGTIFQGRLLHILPAVGRAPRKADEATAGTLKQQRLAARKENAGQAFSWAA
LYLNPDAALAAVADRLGVAKSALLDPSSSDPAVKVALAEAHTLSETKRYLESQHVNVDAF
ARPGPRSATCILVKNLPYATSPAAVQALFAAHGTVSRLLVPPSGTLAIVEMGDRDSAQDA
WKALVYKQFAGSVLYLEKAPAAIWDAPLGAGGGGGDKEQPDVAPVAVDSPSGAAAVGSDE
IPAAQNSTLFVKNLNFATTAPRFKAAFDQLPGFVFARIRTKPDPAAPGRTLSMGFGFVGF
RTVKEAQQALQARREHVLDGHKLAISFAHRGADKAGTASEGSKASAVKGVKDTTAKLLVK
NVPFEATRNDIRQLFSAYGQLKSVRLPRKMDNKTRGFAFVEFATRRDAEAAYDALEHIHL
LGRHLVLQWSGGEDEEGGQDEAHRERAPQARSNRMGKSKFEI