Protein Info for mRNA_2286 in Rhodosporidium toruloides IFO0880

Name: 10654
Annotation: Hypothetical Protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 624 transmembrane" amino acids 39 to 63 (25 residues), see Phobius details amino acids 87 to 112 (26 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 183 to 206 (24 residues), see Phobius details amino acids 262 to 289 (28 residues), see Phobius details amino acids 431 to 453 (23 residues), see Phobius details amino acids 473 to 492 (20 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (624 amino acids)

>mRNA_2286 Hypothetical Protein (Rhodosporidium toruloides IFO0880)
MSSFPFPSNGDNPFAFYRYVLHARAIHLPNDPAGFRVRLIVLFVVVACLFLTSLLNFALH
ILSYRIKGRSIWLFRLVERDGSKRILSNHFALCGIGGAVMFAILFGDCLALWRTYVSPGD
GDGIRHVAIWGFAVWPPAYAVGWTLSWATFQAYGQVASASASLDPAGVDAKGRGWRAGMP
AWLENLLFVGGGIGAVATHSTLAGIASEASDDLWQTFDAFDGYLASQASSWDGSTLTASA
GTQILKGFSEMKKAADHFYYTSANMCIGAAVLPLFLVLVNLVLASFVLMIRQNIRLQLVH
FPTLTASDAAPTNPAAAVSPPADGGKANQPLDPLPSPTSPTLLLPRSSPPIPLSAVPFSP
PTPILSPSPPRMVLSISIDPLTNTPLRTTRPLPTRSHVRAIADDPELAVAGSSSHLYADR
ISALMKAEIELLVIGLSVVIGALALAVTCAWSVTVFRDWENMGWAKQEAVLTLPIWVLGV
GLVVGEGLHAWVEWKYVVGRWWRIERYAQSKERRESDLAAKAASGTGGGSRRFSIRSLGT
RKPFVRSTTTDSTRSTRGVGGGRTSQIGGGGFDGAIEVAIEVMQKEEVDVEVQDEEEAVD
ELLYSGAREKDKGEQPRRKEVWED