Protein Info for mRNA_2338 in Rhodosporidium toruloides IFO0880

Name: 10706
Annotation: K05545 DUS4 tRNA-dihydrouridine synthase 4

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01207: Dus
  • amino acids 121 to 329 (209 residues), 163.6 bits, E=3.1e-52

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Carotenoid biosynthesis - General
• Insect hormone biosynthesis
• Nucleotide sugars metabolism
• Porphyrin and chlorophyll metabolism
• Puromycin biosynthesis
• Trinitrotoluene degradation
• alpha-Linolenic acid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Protein Sequence (379 amino acids)

>mRNA_2338 K05545 DUS4 tRNA-dihydrouridine synthase 4 (Rhodosporidium toruloides IFO0880)
MPHSVNVDEAHGAAAAEELLPQDILREFDGVNACAPMVRYGKLPFRALVSRAAEFSRSAL
ARDSDFTTSPTERGSFYLSEAHAGPPVAEWDASPEPRRGLHSLSNGEGEGGGKRRRRVKG
RLIIQFAANDPVQLADASELAKPWVDGIDLNCGCPQKWAFQEGIGCALLRKPDLVRDLVR
TTKQRIGWDFPVSVKIRVDDDPSRTNELVSNAIAGGADFITVHGRTRHQSSEAYPVNPDA
IAFAASCAKGAVPVVANGDVFSKEDGEELRRRTGVQGVMSARGLLANPALFAGYSQTPLQ
AVQEFLDLSISTGLIFPLFHRHVAYMLESRFANKKDRIGFNGLTSYAGVMDWLEEARMVE
LGGGNGVEGVQRGVNGLRV