Protein Info for mRNA_2348 in Rhodosporidium toruloides IFO0880

Name: 10716
Annotation: K00762 pyrE orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 227 transmembrane" amino acids 37 to 62 (26 residues), see Phobius details TIGR00336: orotate phosphoribosyltransferase" amino acids 16 to 201 (186 residues), 172.2 bits, see alignment E=4.4e-55 PF00156: Pribosyltran" amino acids 75 to 173 (99 residues), 56.2 bits, see alignment E=1.6e-19

Best Hits

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (227 amino acids)

>mRNA_2348 K00762 pyrE orotate phosphoribosyltransferase (Rhodosporidium toruloides IFO0880)
MSATSYAASIIETALASEQPILRFGTFTLKSGRSSPYFFNFGLFNTGSLLLALASAFADA
ILDAYPEIGSSSAGPDTPKVLFGPAYKGIPLVAAIASELARRGRDIGYSYNRKEKKDHGE
GGSIVGAPLKGQKVLIVDDVITAGTAIREAHKIVESEGGQTAGIVEALDREERGQGELST
VQEVEKELGVKVTSVVKMRDIVAWLKEKGKLDEMKAMEEYRAKWGVN