Protein Info for mRNA_2359 in Rhodosporidium toruloides IFO0880
Name: 10727
Annotation: K02927 RP-L40e, RPL40 large subunit ribosomal protein L40e
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 92% identical to RL40_NEUCR: Ubiquitin-60S ribosomal protein L40 (crp-79) from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987)
KEGG orthology group: K02927, large subunit ribosomal protein L40e (inferred from 91% identity to ani:AN4016.2)MetaCyc: 87% identical to ubiquitin-60S ribosomal protein L40 fusion protein (Homo sapiens)
Predicted SEED Role
"ubiquitin / LSU ribosomal protein L40e" in subsystem Ribosome LSU eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (117 amino acids)
>mRNA_2359 K02927 RP-L40e, RPL40 large subunit ribosomal protein L40e (Rhodosporidium toruloides IFO0880) RQITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLV LRLRGGIIEPSLRILASTYNCDKMICRKCYARLPPRATNCRKRSCGHSSQLRPKKKL