Protein Info for mRNA_2380 in Rhodosporidium toruloides IFO0880

Name: 10748
Annotation: K07889 RAB5C Ras-related protein Rab-5C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00231: small GTP-binding protein domain
  • amino acids 15 to 169 (155 residues), 95.3 bits, E=1.7e-31
• PF00025: Arf
  • amino acids 16 to 172 (157 residues), 41.6 bits, E=1.4e-14
• PF00071: Ras
  • amino acids 17 to 173 (157 residues), 183.7 bits, E=3e-58
• PF08477: Roc
  • amino acids 17 to 129 (113 residues), 104.4 bits, E=7e-34

Best Hits

Swiss-Prot: 64% identical to YPT5_SCHPO: GTP-binding protein ypt5 (ypt5) from Schizosaccharomyces pombe (strain 972 / ATCC 24843)

KEGG orthology group: K07976, Rab family, other (inferred from 62% identity to cci:CC1G_00495)

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (3/4 steps found)
• phytol degradation (3/4 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• mitochondrial NADPH production (yeast) (2/5 steps found)
• octane oxidation (2/5 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (4/8 steps found)
• superpathway of ornithine degradation (4/8 steps found)
• D-arabinose degradation I (1/4 steps found)
• putrescine degradation III (1/4 steps found)
• serotonin degradation (3/7 steps found)
• superpathway of L-arginine and L-ornithine degradation (7/13 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (4/9 steps found)
• dopamine degradation (1/5 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (5/11 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• limonene degradation IV (anaerobic) (2/7 steps found)
• superpathway of glycol metabolism and degradation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• alkane oxidation (1/6 steps found)
• aromatic biogenic amine degradation (bacteria) (2/8 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (6/16 steps found)
• superpathway of pentose and pentitol degradation (6/42 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.3

Use Curated BLAST to search for 1.2.1.3

Protein Sequence (211 amino acids)

>mRNA_2380 K07889 RAB5C Ras-related protein Rab-5C (Rhodosporidium toruloides IFO0880)
MSAAAQPAPVPITTARKLVLLGESAVGKSSIVLQFVKKQFDEWRESTIGAAFLTQTVPVK
SGNFIWDTAGQERYKSLAPMYYRSAHAAVVAFDITSSASFEKARSWIAELQRQADPGIVI
VLAGNKLDLVSQRQVSTADAEQFAREEGLLYFEVSAKTAEGIEEMFQTVAEKMPIEPPAG
AGGKRGAGLAGRGGVDLKQTTAQSLVDGCSC