Protein Info for mRNA_2434 in Rhodosporidium toruloides IFO0880

Name: 10802
Annotation: HMMPfam-ATP synthase subunit H-PF05493

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF05493: ATP_synt_H
  • amino acids 1 to 55 (55 residues), 74.1 bits, E=5.1e-25

Best Hits

KEGG orthology group: K02153, V-type H+-transporting ATPase subunit H [EC: 3.6.3.14] (inferred from 57% identity to scm:SCHCODRAFT_61579)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Protein Sequence (55 amino acids)

>mRNA_2434 HMMPfam-ATP synthase subunit H-PF05493 (Rhodosporidium toruloides IFO0880)
IFLTLLIAAGAAAGGWVSVPKGENQVVIRTSITLAITCCWLMWAITYLAQLHPLI