Protein Info for mRNA_2443 in Rhodosporidium toruloides IFO0880

Name: 10811
Annotation: HMMPfam-Peroxidase-PF00141,PRINTS-Haem peroxidase superfamily signature-PR00458,PRINTS-Plant ascorbate peroxidase signature-PR00459,ProSitePatterns-Peroxidases proximal heme-ligand signature.-PS00435,ProSitePatterns-Peroxidases active site signature.-PS00436,ProSiteProfiles-Plant heme peroxidase family profile.-PS50873,SUPERFAMILY--SSF48113

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to CCPR2_USTMA: Putative heme-binding peroxidase (CCP2) from Ustilago maydis (strain 521 / FGSC 9021)

KEGG orthology group: None (inferred from 73% identity to uma:UM01947.1)

Predicted SEED Role

"Ascorbate peroxidase (EC 1.11.1.11)" (EC 1.11.1.11)

MetaCyc Pathways

ascorbate glutathione cycle (2/4 steps found)
L-ascorbate degradation III (3/6 steps found)
ascorbate recycling (cytosolic) (2/6 steps found)
L-ascorbate degradation II (bacterial, aerobic) (2/7 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.11

Use Curated BLAST to search for 1.11.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>mRNA_2443 HMMPfam-Peroxidase-PF00141,PRINTS-Haem peroxidase superfamily signature-PR00458,PRINTS-Plant ascorbate peroxidase signature-PR00459,ProSitePatterns-Peroxidases proximal heme-ligand signature.-PS00435,ProSitePatterns-Peroxidases active site signature.-PS00436,ProSiteProfiles-Plant heme peroxidase family profile.-PS50873,SUPERFAMILY--SSF48113 (Rhodosporidium toruloides IFO0880)
MAPTTQKEAASRKGDYDAVRRDIASILKQPDYDDGSIGPVLVRLAWHASGTYDKETNTGG
SNGAGMRYECEGGDPANAGLEHARRFLEPIKEKHPWITYADLWTLAGVTAIKEMGGPECA
WKPGRTDFVDDSKCPPRGRLPDGALAADHLRHVFYRMGFNDQEIVALAGAHSMGRCHSDR
SGFEGPWSVTPTKFSNQYYKLTKFKWEKKEWNGPVQFKNTDLGEELMMLSTDMALIEDKE
FLPFVKKYAEDREAFYDDFAKVFAKLIELGVERDGKYESAPTFSQEAGDKKEQEAKSKM