Protein Info for mRNA_2454 in Rhodosporidium toruloides IFO0880

Name: 10822
Annotation: K12823 DDX5, DBP2 ATP-dependent RNA helicase DDX5/DBP2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 554 PF00270: DEAD" amino acids 152 to 322 (171 residues), 164.9 bits, see alignment E=2.4e-52 PF04851: ResIII" amino acids 167 to 315 (149 residues), 29.4 bits, see alignment E=1.1e-10 PF00271: Helicase_C" amino acids 361 to 468 (108 residues), 101.7 bits, see alignment E=4.7e-33

Best Hits

Swiss-Prot: 72% identical to DBP2_CRYNB: ATP-dependent RNA helicase DBP2-A (DBP2) from Cryptococcus neoformans var. neoformans serotype D (strain B-3501A)

KEGG orthology group: K12823, ATP-dependent RNA helicase DDX5/DBP2 [EC: 3.6.4.13] (inferred from 72% identity to cne:CNF01240)

Predicted SEED Role

No annotation

Isozymes

Compare fitness of predicted isozymes for: 3.6.4.13

Use Curated BLAST to search for 3.6.4.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (554 amino acids)

>mRNA_2454 K12823 DDX5, DBP2 ATP-dependent RNA helicase DDX5/DBP2 (Rhodosporidium toruloides IFO0880)
MSYGGGYGGGGGGYGGGGGGYGGGGGYGALTSLWAGGETPRAHHFVDAGGGSGYGGGGGY
GGGGDRMSGLGSGLRAQNWDTATLAKFEKNFYEEDPRVAARSEREVAEFRREKEIQIFGQ
NIPKPVTNFDEMNFPSYIMAEIKRAGFTAPSPIQCQAWPMALSGRDLVAVSATGSGKTIS
FALPAMIHINAQPLLSPGDGPIVLILAPTRELAVQIQEECTKFGSSSRIRNTCVYGGVPK
GGQIRDLQRGSEIVIATPGRLIDMLEAGKTNLRRVTYLVLDEADRMLDMGFEPQIRKILD
QIRPDRQTLMFSATWPKEVQKLAHTYLKDFIQVTIGSLELSANLNITQIVEVCSDFEKRG
KLVKHLEKISSENAKVLIFIATKRVADDLTKYLRQDGWPALAIHGDKAQQERDWVLGEFK
SGRSPIMIATDVASRGLDVKDIGYVINYDMPNGIEDYIHRIGRTGRAGAKGTAYSYVTPD
QGRIAKDLVKILQDAKQVVPPQLQEIAMFSSGGGGGRGRGGGGRGGGRGYGGGGGGYGGG
GYGASALFASHTPD