Protein Info for mRNA_2458 in Rhodosporidium toruloides IFO0880

Name: 10826
Annotation: K04799 FEN1, RAD2 flap endonuclease-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00752: XPG_N
  • amino acids 1 to 108 (108 residues), 116.5 bits, E=7.1e-38
• PF00867: XPG_I
  • amino acids 148 to 223 (76 residues), 82 bits, E=3.3e-27

Best Hits

Swiss-Prot: 64% identical to FEN11_LACBS: Flap endonuclease 1-A (FEN11) from Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686)

KEGG orthology group: K04799, flap endonuclease-1 [EC: 3.-.-.-] (inferred from 64% identity to lbc:LACBIDRAFT_254074)

Predicted SEED Role

"Flap structure-specific endonuclease (EC 3.-.-.-)" in subsystem DNA Repair Base Excision or DNA replication, archaeal (EC 3.-.-.-)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
• Puromycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.-.-.-

Use Curated BLAST to search for 3.-.-.-

Protein Sequence (371 amino acids)

>mRNA_2458 K04799 FEN1, RAD2 flap endonuclease-1 (Rhodosporidium toruloides IFO0880)
MGIKGLTALINDFAPKAIKQAEMKTLFGRKVAIDASMSIYQFLIAVRQQDGQQLMNEAGE
TTSHLMGLFYRTIRMVENDLKPCYVFDGKPPQLKSNVLKKRFSNRQEAKADEEEAKETGT
AEDVDRLSRRQVKVTKEHNEECRRLLTLMGIPWVEAPSEAEAQCAELCRGGLVYGAGSED
MDTLTFNSPIVLRHLTFSEARKMPIDIISLDEFIDMCMLCGCDYLEPIKGVGAKTALKLV
RDHETMDDILAHLRKGKNPPPEDWPYEEARKLFQTPDVKPAKDIELKWEAPDVEGLVDFL
VREKGFSEERVRKGADKLKLRLSAKQQGRLDGFFTVQAPKDDGKKRKADDKEDAKGGKKA
KTDSKAKGKKK