Protein Info for mRNA_2520 in Rhodosporidium toruloides IFO0880

Name: 10888
Annotation: KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 237 to 259 (23 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 308 to 339 (32 residues), see Phobius details PF03151: TPT" amino acids 51 to 340 (290 residues), 58.3 bits, see alignment E=4.2e-20

Best Hits

KEGG orthology group: None (inferred from 60% identity to mgl:MGL_2273)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>mRNA_2520 KOG1441 Glucose-6-phosphate/phosphate and phosphoenolpyruvate/phosphate antiporter (Rhodosporidium toruloides IFO0880)
MGLRDSASASDGFASSGAARGLGEMRRCSPLSANTGEAYRREQWERMMQTAPIIAIWIAL
SSSVILFNAWILGDDPGDLNFRFPIFLTTTHLAYATVGTRLMRRFTHLLDGLDNVEMTWD
RWYKNIVPIGGLFSASLIFSNLAYLTLTVSFIQMLKAFTSVAVMGMSVLMGLERFNQRTA
TIVVAISAGVALASYGELNFVFSGFIFQCFGILFEATRLVAIQKLLSGLRMDPLVSLYYY
APVCAAFNSLLIPIFEGWAPFEQVLPRVGAFTLFLNCNVALLLNISVVFLIGCASSLVLT
LSGVLKDILLVVGSVVLFGSTVTFLQMFGYGIALLGLFVFKTPEDVMAAYIAQAKRLVGR