Protein Info for mRNA_2568 in Rhodosporidium toruloides IFO0880

Name: 10936
Annotation: KOG2504 Monocarboxylate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 58 to 78 (21 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 124 to 148 (25 residues), see Phobius details amino acids 154 to 176 (23 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 296 to 318 (23 residues), see Phobius details amino acids 333 to 355 (23 residues), see Phobius details amino acids 361 to 383 (23 residues), see Phobius details amino acids 395 to 419 (25 residues), see Phobius details amino acids 434 to 456 (23 residues), see Phobius details PF07690: MFS_1" amino acids 65 to 301 (237 residues), 63.1 bits, see alignment E=2.3e-21 amino acids 298 to 449 (152 residues), 49.7 bits, see alignment E=2.7e-17 PF13347: MFS_2" amino acids 178 to 436 (259 residues), 37 bits, see alignment E=1.7e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (464 amino acids)

>mRNA_2568 KOG2504 Monocarboxylate transporter (Rhodosporidium toruloides IFO0880)
MSSTSIELSTLDHTSTAPSRAPSTRSTTQLEDAGRDEQPPEGKEAFDSYPEWRAWKQLVA
CFLLFFTSLGGVYSWGVFQGALVRAGLAPSSTLAFIGATLAAMQAIFAIPSARLVSAYGP
RRMALIGTSLVGSGPVLASFCTHSVAGLVVTEGFMYGIGQALLFCCGATLPSAYFLKSRN
VATGFVYSGAGIGGAAFSLATAQLFKSLNSLPWTFRTVGLIMTVINVPASLVLRGRAERR
PLRLGKRREEEEGERKEKYFDWTMFRDPRFCLILAGTAIAVFPLFVPPFFLPLYGISIGL
SATTASYILAGFNLSSALGRICFGLGADRLLGSLNSLVVCLAMVAVSTLLVWPFAEHLGP
LIAFAVINGFCAGGMFSLIPGTLSSVFGSRKLPAIFSFIITSYSFGYFLGAPIAGFLLQA
YGGPDKGPEAYKPAIFYAGGVSVVATLLVGGARALVTRQVFRKV