Protein Info for mRNA_2578 in Rhodosporidium toruloides IFO0880

Name: 10946
Annotation: KOG3574 Acetyl-CoA transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 transmembrane" amino acids 93 to 117 (25 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 160 to 177 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 271 to 292 (22 residues), see Phobius details amino acids 360 to 379 (20 residues), see Phobius details amino acids 391 to 409 (19 residues), see Phobius details amino acids 421 to 444 (24 residues), see Phobius details amino acids 528 to 548 (21 residues), see Phobius details PF13000: Acatn" amino acids 93 to 386 (294 residues), 382.5 bits, see alignment E=1.7e-118 amino acids 388 to 565 (178 residues), 176.6 bits, see alignment E=4.1e-56

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>mRNA_2578 KOG3574 Acetyl-CoA transporter (Rhodosporidium toruloides IFO0880)
MPASADRQPSDATAERPFASSSSSSAPTSMLQRGPVRERNVEDEIELVENGTYPSNGGAR
EEKTGLVSGIVGERSIEAGGEGGTLSTRDKRALALLVALYLLQGIPVGLAFGSIPFLLRS
KLSYSQIGIFTLCTYPYSLKLLWSPIVDSIFSPKLGRRKSWIVPIQTIVGILFWWLGNNV
QQMMEVEEPNVHLLTSLFFTLVFFAATQDIAVDGWALTLLSKENLSYASTAQTIGLNTGY
FLSFTVFLAFNSVEFSNKYFRSTPLDYPLISLSGYLHFWAFAFVAVTAYLAFFQPEDPVT
AQDQDDMDLKKVYSIMVEICKLKHVQSFMMVHLVTKLGTAANDAATSLKLLEKGLKKEDL
ALAVLIDFPFQILFGYLAAKWSKGEKPLRPWLIAMWTRLGWAAISMLLISNFPKGDIGTW
YFLLVVACTVGSSFSSTVQFVGISAFHTQIADPLIGGTYMTLLNTVSNLGGTWPKFFVLK
GIDAFSVAVCHVKDEGLDVIVSSRECVSDHGKAACAELGGTCLTERDGYYWVSTLCILTG
VAILVSFVQPVARRLQTLPAAAWRIKRNGR