Protein Info for mRNA_2610 in Rhodosporidium toruloides IFO0880

Name: 10978
Annotation: HMMPfam-OsmC-like protein-PF02566,SUPERFAMILY--SSF82784,TIGRFAM-organ_hyd_perox peroxiredoxin, Ohr subfamily-TIGR03561

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 175 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03561: peroxiredoxin, Ohr subfamily" amino acids 32 to 174 (143 residues), 108.6 bits, see alignment E=1.5e-35 PF02566: OsmC" amino acids 64 to 172 (109 residues), 48.8 bits, see alignment E=4.3e-17

Best Hits

KEGG orthology group: None (inferred from 41% identity to ppy:PPE_01246)

Predicted SEED Role

"Organic hydroperoxide resistance protein" in subsystem Oxidative stress

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (175 amino acids)

>mRNA_2610 HMMPfam-OsmC-like protein-PF02566,SUPERFAMILY--SSF82784,TIGRFAM-organ_hyd_perox peroxiredoxin, Ohr subfamily-TIGR03561 (Rhodosporidium toruloides IFO0880)
MLRSAIARTAAPARSAALAARRTYVNLAPISTSHATSSGSRAAGHVKTNQGAEFKMDLQK
ELGGAGKHLNPEVLLAAGYGTCFLSALAATHGNLHKDAKPLPKSAKVDTEVTIGKDAHEK
TPGFFLAVNLKVHSAPLKEVGLSDEQIHKLVEEAHKLCPYSRAFKGNVDVKLSVV