Protein Info for mRNA_2630 in Rhodosporidium toruloides IFO0880

Name: 10998
Annotation: KOG1581 UDP-galactose transporter related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 131 to 147 (17 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 214 to 237 (24 residues), see Phobius details amino acids 249 to 269 (21 residues), see Phobius details amino acids 276 to 298 (23 residues), see Phobius details amino acids 304 to 322 (19 residues), see Phobius details amino acids 381 to 401 (21 residues), see Phobius details PF08449: UAA" amino acids 14 to 324 (311 residues), 96.7 bits, see alignment E=1.6e-31 PF00685: Sulfotransfer_1" amino acids 519 to 612 (94 residues), 25.5 bits, see alignment E=8.9e-10

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>mRNA_2630 KOG1581 UDP-galactose transporter related protein (Rhodosporidium toruloides IFO0880)
MAEGDSVRRVSLVVHAFGLIAVYSLYGLLQEKIVKSSTYGPNKEHFTSSSLLIVLNRLFS
IAVGLVILFWKARQEPEHSSFAQRLRPVSPYRAYASYVSYTTQSLAKTSKMIPVLFVGAC
VYRKTHRPREWVAAAVIFAGCATYLLSTPPNSRAHDSPGAVTDRSNALIGAIYLLGYLFF
DGLVSSTQEAVFGKNPSSTDPFGPQSPVLDQMVWTNTFAALIAVAASIASTTTGSFWPNV
DLLFSSTRLMRDVCLLSAASALGLIILLNTISSFSALTASLIMTIRQFLSILINAAAFGN
LARVSQVGWIGVFWVASGIWIKINKRYDSRGNGGAISDGEGGDAEEMQEMLEKESRSGSI
PSTTDAPPTSHGQVKQIVMQYLVPLAIPVLGALLLVPILSFSSRPAVTIVGSRWDSQVHQ
AVSPACDTELVTVPYQPTSRVALASFPRSGNSYLRSLVERATGFQTSSVYCDPELERTFH
GECNHTLTFFVKTHFPALPTVVSPNDSAHADYHKQFDSAIHLVRNPLDAISSWYHFLHTS
RTAEGVYNHTARVELPGGKFGKEQRKEILEYAKRWRRHTTYWQHAPISTRVLRYEDLTAR
LIPNMMSVLAFLLPDDNLPSLEHVICVVEHHENLQAYKSSRAAAFAQWDKYDPSLRNEIL
EIVRRPFCRLGYRRVLLKAKGDLPEVQNAMNGHAVSVAQRLNVHAYRLLPQVL