Protein Info for mRNA_2634 in Rhodosporidium toruloides IFO0880

Name: 11002
Annotation: KOG2234 Predicted UDP-galactose transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 735 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 64 (19 residues), see Phobius details amino acids 126 to 143 (18 residues), see Phobius details amino acids 162 to 179 (18 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 215 to 236 (22 residues), see Phobius details amino acids 248 to 264 (17 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 311 to 330 (20 residues), see Phobius details amino acids 336 to 352 (17 residues), see Phobius details amino acids 373 to 393 (21 residues), see Phobius details PF04142: Nuc_sug_transp" amino acids 138 to 351 (214 residues), 73.9 bits, see alignment E=6.8e-25 TIGR00803: UDP-galactose transporter" amino acids 140 to 351 (212 residues), 63.8 bits, see alignment E=9.5e-22

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (735 amino acids)

>mRNA_2634 KOG2234 Predicted UDP-galactose transporter (Rhodosporidium toruloides IFO0880)
MGLSGALTSAWTRGLSCAAALVAVQCSIGILFRLSQSNGRYGFSPASSLTLTEFLKFGIS
CVLFARELRDKESPNAAYAMLGADEGEDESKEPLVDEEGDVEAQAGGRRAPGGAIVRLWR
AWKSNLSTPIVLGFGGLAVFYAANNNVMFLVYRLADPGTVQLVKSSSTFVTAAICFLFLG
RSLREMQWYALVLQTFGLLVTQTVGSATVQPASTYALLVGVTTISATAGVANDFLCKHFD
ASLHAENMVLYMFGVGLNLVIYVIRRMSLPDEPGFFTGYGKLEAILLIFLNATVGVVITF
VYKYADAIVKGIATSTTTAILICVSILFFGMPWSPSAVVGCLSIFLASWAYIRAGMKPAS
DSKKAPPPKRIKAGVAVWLLLLVVVAAILASSGIDSPESEPAWHPSVCERKALPTKRYYP
AKPGGAFEDILVVVFWNENVYDDNRDAFEAVYGEFFPNMIFVGPVPRDYTSRTADHMLDI
WPISSTTYYTHRKLHAVMTEFPCYRGYLWAGFDTFLNSHRLALFDQDKLWNTLPEAEPVL
PETYDNEGKVWNTVTRFGPPFPLDQAHRDDWHWPWAFKPCLDAVNASTPNVKERWQRYHK
KHFPGAPRLLRAMTDVAYIPHTKRDLVLEATPLFVDCFLEIGLPTFTAIALDEGEKPERL
EFHNVLYNRAVNETLIQQVWDRGGEIDAMHQFNWREPGPAGERGSWHLREGIVDKMRQML
REEGERWGVESRRRR