Protein Info for mRNA_2700 in Rhodosporidium toruloides IFO0880

Name: 11068
Annotation: K03019 RPC11, POLR3K DNA-directed RNA polymerase III subunit RPC11

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02150: RNA_POL_M_15KD
  • amino acids 1 to 33 (33 residues), 32.2 bits, E=8e-12
• PF01096: TFIIS_C
  • amino acids 67 to 107 (41 residues), 65.5 bits, E=3.2e-22

Best Hits

Swiss-Prot: 56% identical to RPC10_HUMAN: DNA-directed RNA polymerase III subunit RPC10 (POLR3K) from Homo sapiens

KEGG orthology group: K03019, DNA-directed RNA polymerase III subunit RPC10 (inferred from 60% identity to nvi:100116133)

Predicted SEED Role

"DNA-directed RNA polymerase III 12.5 kDa polypeptide (EC 2.7.7.6)" in subsystem RNA polymerase III (EC 2.7.7.6)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Protein Sequence (109 amino acids)

>mRNA_2700 K03019 RPC11, POLR3K DNA-directed RNA polymerase III subunit RPC11 (Rhodosporidium toruloides IFO0880)
MIFCPYCANQLGLVEGTSGNKFGCQTCPYEYPLNKRYMERTYLKRKAVDDVLGGEDSWKN
VDSTAVDCPKECGSDRAFFMQIQIRSADEPSTTFYKCCNMSCNHQWREN