Protein Info for mRNA_2706 in Rhodosporidium toruloides IFO0880

Name: 11074
Annotation: HMMPfam-PLAC8 family-PF04749,TIGRFAM-A_thal_Cys_rich uncharacterized Cys-rich domain-TIGR01571

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 transmembrane" amino acids 96 to 115 (20 residues), see Phobius details TIGR01571: uncharacterized Cys-rich domain" amino acids 39 to 152 (114 residues), 69.8 bits, see alignment E=1.5e-23 PF04749: PLAC8" amino acids 41 to 151 (111 residues), 78 bits, see alignment E=4.9e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (199 amino acids)

>mRNA_2706 HMMPfam-PLAC8 family-PF04749,TIGRFAM-A_thal_Cys_rich uncharacterized Cys-rich domain-TIGR01571 (Rhodosporidium toruloides IFO0880)
MSVTSEKPTVMQQPSATAPMTFTNDAPPAANAGPAGQPRDWSTGVCGCLDGDFGGFCLSC
WCPCIVYSQYKSRLDHLKATGRAMPPEQVESFGTPGVLWLALNCCAGFAWILDFMARDEI
RKRYNIRGDGMTDCLTSCCCLPCAQRQHHRELLVEEQHQWGANTNGMQQHAPTLDQHYPA
TQEPAQQQQYTTQAPPPTN